The short version of reverse-phase HPLC fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-05. Anything still debated is marked as such rather than presented as settled.
Solvent selection affects pH, ionic strength, and preservative content in the final liquid. Sterile water and bacteriostatic water containing benzyl alcohol are common in laboratory settings. Buffer systems may be used when a peptide is sensitive to pH shifts during dissolution. Acidic or basic conditions can change the net charge of ionizable groups and therefore solubility. Organic cosolvents are sometimes added for hydrophobic sequences, though they can also promote unfolding or aggregation.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
Lyophilization removes water from a peptide solution under vacuum, leaving a porous cake or a loose powder. The dry form often improves stability during shipping and storage because water-mediated degradation slows. Reconstitution reverses the process by adding a solvent so peptide molecules hydrate and enter solution. Complete dissolution depends on peptide sequence, purity, salt form, and any excipients present. Some lyophilized powders dissolve quickly, while others form haze, gels, or persistent particles.
During reconstitution, liquid is directed toward the wall of the vial rather than forcefully onto the powder. Gentle swirling or inversion mixes the contents without creating excessive foam or shear. Foaming can denature some peptides and can make volume measurement difficult. Complete dissolution is often confirmed by visual inspection against a light source. Particles, cloudiness, or undissolved material may indicate incomplete mixing, aggregation, or a solubility limitation that requires further investigation.
Peptide reconstitution is the addition of a liquid to a dried peptide preparation so that the peptide dissolves and forms a solution. Many research peptides are supplied as lyophilized powders, a form produced by freezing and then removing solvent under vacuum. The dried material often appears as a cake or fluffy powder. Dissolution depends on the peptide's sequence, charge, and hydrophobicity. Not all peptides dissolve equally in the same liquid.
| Property | Value | Notes |
|---|---|---|
| Physical form before reconstitution | Lyophilized powder or cake | Appearance depends on formulation and drying cycle |
| Common solvent class | Aqueous, often sterile or bacteriostatic | Buffer or cosolvent may be required for some sequences |
| Key solution variable | pH | Charge state and solubility can change sharply near the isoelectric point |
| Typical solubility range | Micrograms to milligrams per milliliter | Wide variation across peptide sequences and salt forms |
| Primary visual check | Clarity and absence of particles | Haze or gel formation may indicate incomplete dissolution or aggregation |
Cloudiness, particles, or gel formation after reconstitution can signal incomplete dissolution, aggregation, or contamination. A clear solution is not proof of purity, and a cloudy one is not always unusable if the peptide is designed to form suspensions. pH measurement can identify whether the solution matches the intended range, and buffer exchange may be needed when the original solvent is incompatible. Sterile filtration is sometimes used for microbial control, but filters can adsorb peptides and reduce concentration. Documentation of lot number, solvent, volume, date, and storage condition supports later traceability in laboratory records.
Once a peptide is in liquid form, its stability depends on temperature, pH, concentration, and the presence of oxygen or microbes. Refrigeration slows many degradation pathways, while freezing can extend storage for longer periods. Repeated freeze-thaw cycles are generally avoided because ice crystal formation and concentration changes can promote aggregation. Light exposure can also damage peptides that contain aromatic or sulfur-containing residues. A common laboratory practice is to divide a reconstituted stock into single-use aliquots before freezing, but the optimal storage condition remains peptide-specific and is often determined empirically.
Reconstitution concentration is chosen from the mass of peptide and the volume of solvent added. Researchers often prepare a concentrated stock and then divide it into single-use aliquots to reduce freeze-thaw cycling. The actual peptide content may differ from label mass because of counterions, water, or impurities. For that reason, quantitative work may require independent measurement such as amino acid analysis or ultraviolet absorbance. Records of solvent, volume, date, and lot help trace later observations.
Lyophilized peptides are supplied as dry powders or porous cakes that remain stable during shipment and short-term storage. Reconstitution is the laboratory step of adding a suitable solvent so the solid dissolves into a liquid stock. The dried state limits hydrolysis and microbial growth, but it does not remove all residual water or salts. Sequence, counterion, and manufacturing method influence how quickly and completely a peptide enters solution. Researchers treat reconstitution as a practical starting point for later dilution, analysis, or assay work.
Solvent choice depends on peptide polarity and intended use. Many peptides dissolve in water or buffered aqueous solutions, while hydrophobic sequences may need a small amount of organic solvent such as acetonitrile or dimethyl sulfoxide before aqueous dilution. The solvent should match the downstream analytical method and not interfere with detection. Gentle mixing or brief sonication can help, but vigorous agitation may promote foaming or aggregation. Complete dissolution is judged by a clear liquid free of visible particles, though some turbidity can persist.
Quality checks after reconstitution include visual inspection, pH measurement, and analytical methods such as reversed-phase high-performance liquid chromatography. These tests can detect insoluble material, degradation products, and changes in concentration. Mass spectrometry is often used to confirm molecular identity when the peptide sequence is known. Because a clear solution can still contain aggregates or modified peptide, visual clarity alone is not sufficient. Analytical results are compared with a reference standard or the pre-reconstitution certificate of analysis.
Container selection matters because peptides can adsorb to glass, plastic, and filter membranes. Low-binding polypropylene tubes reduce losses for hydrophobic sequences, and filtration through a 0.22 µm membrane can remove particulates and microorganisms. Some peptides may bind to certain filter materials, so compatibility should be checked. Aliquots should be prepared before freezing to avoid repeated temperature cycling. Labels should record the peptide identity, lot number, solvent, concentration, reconstitution date, and storage condition.
After reconstitution, the peptide solution is less stable than the dried powder because water enables hydrolysis, oxidation, and microbial growth. Storage temperature, pH, buffer composition, and container material all affect how long the solution remains usable. Many peptides are kept at 2–8 °C for short-term work, while frozen aliquots at −20 °C or below are used for longer intervals. Repeated freeze-thaw cycles can cause aggregation or precipitation. The choice of storage condition should be based on stability data for the specific peptide.
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Solvent selection depends on the peptide's charge, hydrophobicity, and intended application. Many lyophilized peptides dissolve readily in water, while others require a small amount of a miscible organic solvent, a dilute acid, or a dilute base before aqueous dilution. A buffer may be used when a stable pH range is known, but adding buffer salts can also promote aggregation or precipitation. Dissolution should be observed rather than assumed, because a clear solution does not prove that the peptide is monomeric or fully active. The order of solvent addition and the final volume matter for achieving the intended concentration.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Molecular biomarkers have been defined as biomarkers that can be discovered using basic and acceptable platforms such as genomics and proteomics. Many genomic and proteomics techniques are available for biomarker discovery and a few techniques that are recently being used can be found on that page. Apart from genomics and proteomics platforms biomarker assay techniques, metabolomics, lipidomics, glycomics, and secretomics are the most commonly used as techniques in identification of biomarkers. Biomarkers can be classified on their clinical applications as molecular biomarkers, cellular biomarkers or imaging biomarkers. Four of the main types of molecular biomarkers are genomic biomarkers, transcriptomic biomarkers, proteomic biomarkers and metabolic biomarkers.
Autosomal-dominant mutations in APP cause hereditary early-onset Alzheimer's disease (familial AD, fAD). This form of AD accounts for no more than 10% of all cases, and the vast majority of AD is not accompanied by such mutations. However, familial Alzheimer's disease is likely to result from altered proteolytic processing. This is evidenced by the fact that many mutations that lead to fAD occur near γ-secretase cleavage sites on APP. One of the most common mutations causing fAD, London Mutation, occurs at codon 717 of the APP gene, and results in a valine to isoleucine amino acid substitution. Histochemical analysis of the APP V717I mutation has revealed extensive Aβ pathology throughout neuroaxis as well as widespread cerebral amyloid angiopathy (CAA). The gene for the amyloid precursor protein is located on chromosome 21, and accordingly people with Down syndrome have a very high incidence of Alzheimer's disease.
Apitegromab, sold under the brand name Isembyld, is a fully human IgG4 lambda monoclonal antibody used for the treatment of spinal muscular atrophy. It is a recombinant monoclonal antibody targeting proforms of myostatin. The most common side effects include upper respiratory tract infections, vomiting, cough, other viral infections, headache, gastroenteritis, and pharyngitis (sore throat). Apitegromab was approved for to treat Spinal Muscular Atrophy in the United States in September 2026. Apitegromab is indicated for the treatment of spinal muscular atrophy in people aged two years of age and older who are currently receiving a survival motor neuron 2-targeted treatment.Spinal muscular atrophy is a rare, progressive neuromuscular disease affecting approximately 1 in 10,000 live births and is among the leading genetic causes of infant mortality. It is caused by a faulty survival motor neuron 1 (SMN1) gene that fails to produce a protein essential for motor neuron survival, leading to progressive muscle weakness and wasting.
The Analytical Information Markup Language (AnIML) is an open ASTM XML standard for storing and sharing analytical chemistry and biological data. A main reason of using AnIML is that FAIR data (Findable, Accessible, Interoperable and Reusable) standards are automatically implemented. As AnIML's structure is human-readable, Accessibility is given. Interoperability, Reusability and Findability are secured by the AnIML Core and AnIML Technique Definitions. AnIML has been continuously worked on starting from 2003 up to 2020. The last AnIML Core Version update happened in 2010. So far, no standardisation document nor public example files have been published. The standard exists only in pre-release form. AnIML is a XML standard which consists of two logical layers:
Sources: en.wikipedia.org
The period from 1958 to 1968 saw tremendous growth in aviation. Improvements in aviation safety and accident investigation procedures were rapidly advancing. In 1963, the Civil Aeronautics Board, under the leadership of then Deputy Director Bobbie R. Allen, established the National Aircraft Accident Investigation School in Oklahoma City. The ICAO's third accident investigation division meeting, held in Montreal, Canada, in January 1965, laid the foundation for accident investigations throughout the world. The proposals were presented by the Director of the Civil Aeronautics Board Bureau of Safety, Bobbie R. Allen, who headed the U.S. delegation. The U.S. formally adopted the proposals at the White House on December 1, 1965. The top 10 countries with the highest number of fatal civil airliner accidents from 1945 to 2021 are the United States, Russia, Canada, Brazil, Colombia, United Kingdom, France, Indonesia, Mexico, and India. The United Kingdom is noted to have the highest number of air crashes in Europe, with a total of 110 air crashes within the time period, and Indonesia is the highest in Asia at 104, followed by India at 95.
The carbohydrate-insulin model (CIM) posits that obesity is caused by excess consumption of carbohydrate, which then disrupts normal insulin metabolism leading to weight gain and weight-related illnesses. It is contrasted with the mainstream energy balance model (EBM), which holds that obesity is caused by an excess in calorie consumption compared to calorie expenditure. According to the carbohydrate–insulin model, low-carbohydrate diets would be the most effective in causing long-term weight loss. Notable proponents of the carbohydrate–insulin model include Gary Taubes and David Ludwig. The CIM has been tested in mice and humans. Although some experts consider that these studies falsified the CIM, proponents disagree. Available evidence does not support the existence of a long-term advantage in weight loss for low-carbohydrate diets.
Across several benchmarks, AlphaFold3 has demonstrated, on average, superior performance to conventional search-based docking algorithms in predicting small-molecule–protein binding modes. AlphaFold 3 version can predict structures of protein complexes with a very limited set of selected cofactors and co- and post-translational modifications. Between 50% and 70% of the structures of the human proteome are incomplete without covalently-attached glycans. Studies have shown that although AlphaFold3 can jointly model protein–ligand co-folding, its accuracy drops markedly on test cases with low similarity to its training data—an area of particular importance for drug discovery. Other work has found that AlphaFold is insensitive to adversarial decoys generated by altering the physicochemical properties of binding pockets, suggesting potential reliance on training-set memorization rather than genuine chemical awareness.
The cell-mediated response to the virus and to vectors is poorly characterised, and has been largely ignored in the literature as recently as 2005. Clinical trials using an AAV2-based vector to treat haemophilia B seem to indicate that targeted destruction of transduced cells may be occurring. Combined with data that shows that CD8+ T-cells can recognise elements of the AAV capsid in vitro, it appears that there may be a cytotoxic T lymphocyte response to AAV vectors. Cytotoxic responses would imply the involvement of CD4+ T helper cells in the response to AAV and in vitro data from human studies suggests that the virus may indeed induce such responses, including both Th1 and Th2 memory responses. A number of candidate T cell stimulating epitopes have been identified within the AAV capsid protein VP1, which may be attractive targets for modification of the capsid if the virus is to be used as a vector for gene therapy. There are several steps in the AAV infection cycle, from infecting a cell to producing new infectious particles:
Bruce Randall Donald (born 1958) is an American computer scientist and computational biologist. He is the James B. Duke Professor of Computer Science and Biochemistry at Duke University. He has made numerous contributions to several fields in Computer Science such as robotics, Microelectromechanical Systems (MEMS), Geometric & physical algorithms and computational geometry, as well as in areas of Structural Molecular Biology & Biochemistry such as Protein design, Protein Structure Determination and Computational Chemistry.
Sources: en.wikipedia.org
It is the process of adding a liquid solvent to a dried peptide powder so that the peptide dissolves and forms a solution. The dried form is usually produced by lyophilization, and the solvent is chosen based on the peptide and the intended laboratory use.
Incomplete dissolution can result from low solubility, an unsuitable pH, or aggregation. It may also reflect residual salts, fillers, or manufacturing impurities that do not dissolve under the chosen conditions.
Yes. Solvent pH, ionic strength, preservatives, and cosolvents can all influence degradation or aggregation. A solvent that gives a clear solution does not automatically provide the best long-term stability.
Lyophilized means the material was frozen and then dried under vacuum, leaving a solid powder or cake. The process removes most of the water or solvent. The resulting peptide is typically more stable for storage than a solution.