A practical reference on peptide stability: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-02-16. Anything still debated is marked as such rather than presented as settled.
Once reconstituted, a peptide solution is generally less stable than the dry powder. Hydrolysis, oxidation, aggregation, and microbial growth can change the preparation over time, so storage temperature and duration are practical concerns. Dividing a solution into single-use aliquots before freezing can reduce repeated freeze-thaw cycles, which may otherwise cause precipitation or loss of activity. The optimal storage conditions vary by peptide, and no single rule applies to all sequences. Records of solvent, concentration, date, and storage history help maintain traceability. Studies often report stability under defined conditions rather than universal shelf lives.
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Solvent selection depends on the peptide's charge, hydrophobicity, and intended application. Many lyophilized peptides dissolve readily in water, while others require a small amount of a miscible organic solvent, a dilute acid, or a dilute base before aqueous dilution. A buffer may be used when a stable pH range is known, but adding buffer salts can also promote aggregation or precipitation. Dissolution should be observed rather than assumed, because a clear solution does not prove that the peptide is monomeric or fully active. The order of solvent addition and the final volume matter for achieving the intended concentration.
Analytical checks help determine whether a reconstituted peptide matches its expected identity and purity; reverse-phase high-performance liquid chromatography separates components by hydrophobicity and can reveal degradation products or impurities. Mass spectrometry provides a mass measurement that supports sequence identity when compared with the theoretical value. Ultraviolet absorbance at 280 nm can estimate concentration for peptides containing tryptophan or tyrosine, though sequence-dependent extinction coefficients are needed. For shorter or non-aromatic peptides, other methods such as amino acid analysis may be required. These techniques describe the material rather than guarantee its biological effect.
Cloudiness, particles, or gel formation after reconstitution can signal incomplete dissolution, aggregation, or contamination. A clear solution is not proof of purity, and a cloudy one is not always unusable if the peptide is designed to form suspensions. pH measurement can identify whether the solution matches the intended range, and buffer exchange may be needed when the original solvent is incompatible. Sterile filtration is sometimes used for microbial control, but filters can adsorb peptides and reduce concentration. Documentation of lot number, solvent, volume, date, and storage condition supports later traceability in laboratory records.
| Property | Value | Notes |
|---|---|---|
| Physical state before reconstitution | Lyophilized powder or cake | Appearance varies from fluffy to compact; not a solution. |
| Common solvent | Sterile or ultrapure water | Many peptides dissolve, but solubility is sequence-dependent. |
| Alternative solvent | Dilute acetic acid or acetonitrile/water | Used for hydrophobic or basic peptides; compatibility varies. |
| Typical storage after reconstitution | 2–8 °C short term; −20 °C or below for aliquots | Stability is peptide-specific; avoid repeated freeze-thaw. |
| Common analytical method | Reverse-phase HPLC | Assesses purity and concentration; mass spectrometry confirms identity. |
After reconstitution, peptide solutions are generally less stable than lyophilized powders, and hydrolysis, oxidation, deamidation, and aggregation can occur in solution. Stability depends on peptide sequence, concentration, pH, buffer composition, temperature, light exposure, and dissolved oxygen. Many research protocols store reconstituted solutions at 4 °C for short periods or at -20 °C or -80 °C for longer periods. Repeated freeze-thaw cycles can promote aggregation and loss of activity. The optimal storage condition is peptide-specific and often determined empirically rather than predicted from sequence alone.
Quality control after reconstitution often includes visual inspection for particulates, pH measurement, and concentration determination by ultraviolet absorbance at 280 nm when aromatic residues are present. Reverse-phase high-performance liquid chromatography can assess purity and reveal degradation peaks. Mass spectrometry confirms molecular identity and detects modifications such as oxidation or truncation. Size-exclusion chromatography can quantify aggregates and oligomers. These methods are established for many peptides but may require optimization for hydrophobic or chemically modified sequences.
After reconstitution, a peptide solution is typically stored under conditions that limit degradation. Cool temperatures slow hydrolysis and oxidation, while freezing can preserve samples for longer periods. Repeated freeze-thaw cycles may promote aggregation or precipitation, so aliquoting before freezing is a common laboratory practice. The optimal storage temperature depends on the peptide sequence, buffer composition, and expected duration. Solutions containing oxidizable residues may benefit from inert gas overlays or antioxidants, though compatibility with the specific peptide must be considered.
Aseptic technique matters because aqueous peptide solutions can support microbial growth. Sterile solvents, clean workspaces, and sterile filtration can reduce contamination. The choice of filter material and pore size must avoid peptide loss through adsorption, especially for hydrophobic or low-concentration samples. Visual inspection for particles, turbidity, or color change provides a simple initial check, but it cannot confirm identity or purity. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to verify composition and detect degradation products.
Documentation supports reproducibility and traceability. Records often include lot number, solvent composition, final concentration, preparation date, and storage location. Such details help distinguish procedural variation from actual sample instability. Questions remain about how best to predict long-term stability from short-term accelerated studies, because peptide degradation pathways differ widely. For many peptides, the relationship between in vitro solution stability and biological behavior is incompletely understood and is an active area of research.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
Pinhasov is a researcher at the Department of Molecular Biology and Dr. Miriam and Sheldon G. Adelson School of Medicine. His research focuses on the molecular mechanisms of mental disorders and the relationship between psychiatric deviations and stress sensitivity. His laboratory group has developed a selectively bred mouse model with strong features of dominance and submissiveness. These mice respectively exhibit manic-like and depression-like behavior with different responses to psychotropic agents and environmental stimuli, demonstrating differential sensitivity to stress. His group showed that inherited susceptibility to stress is linked to gradual development of chronic inflammation, wide-spectrum metabolic alterations, brain neurotransmission deterioration, electrical activity accompanied behavioral disturbances in emotional and cognitive domains, and reduced life expectancy. The Dominant-Submissive mouse model has been shown to be a successful and unique tool for studying the mechanisms of aging related cognitive impairments, mental disorders, and their effects on the entire organism.
Sources: en.wikipedia.org
Greater emphasis on risk management Introduces “Special Requirements” Introduces “Critical Items” Measure: Requirements conformance Measure: Delivery performance Adopt proven product development processes Eliminate “recurring corrective actions” AS9100 Revision C was released in January, 2009, with considerable delay in application of the new version in audits, largely due to the delay in the release of AS9101 Revision D and auditor training to the increased auditing rigor of that update. AS9100 Revision D (2016), Quality Management System – Requirements for Aviation, Space and Defense Organizations The update of AS9100 from revision C to D includes the full text of ISO 9001:2015. In addition to aligning the structure of the aviation, space and defense requirements to the new structure of ISO 9001:2015, the following key changes were implemented:
The prevalence of abdominal obesity is increasing in Western populations, possibly due to a combination of low physical activity and high-calorie diets, and also in developing countries, where it is associated with the urbanization of populations. Other environmental factors, such as maternal smoking, estrogenic compounds in the diet, and endocrine-disrupting chemicals may be important also. Hypercortisolism, such as in Cushing's syndrome, also leads to central obesity. Many prescription drugs, such as dexamethasone and other steroids, can also have side effects resulting in central obesity, especially in the presence of elevated insulin levels. There are various ways of measuring abdominal obesity including: Absolute waist circumference (>102 cm (40 in) in men and >88 cm (35 in) in women) Waist–hip ratio (the circumference of the waist divided by that of the hips of >0.9 for men and >0.85 for women) Waist-stature ratio (waist circumference divided by their height, >0.5 for adults under 40 and >0.6 for adults over 50) Sagittal Abdominal Diameter
the cAMP signal pathway and the phosphatidylinositol signal pathway. When a ligand binds to the GPCR it causes a conformational change in the GPCR, which allows it to act as a guanine nucleotide exchange factor (GEF). The GPCR can then activate an associated G protein by exchanging the GDP bound to the G protein for a GTP. The G protein's α subunit, together with the bound GTP, can then dissociate from the β and γ subunits to further affect intracellular signaling proteins or target functional proteins directly depending on the α subunit type (Gαs, Gαi/o, Gαq/11, Gα12/13). GPCRs are an important drug target, and approximately 34% of all Food and Drug Administration (FDA) approved drugs target 108 members of this family. The global sales volume for these drugs is estimated to be 180 billion US dollars as of 2018. It is estimated that GPCRs are targets for about 50% of drugs currently on the market, mainly due to their involvement in signaling pathways related to many diseases i.e. mental, metabolic including endocrinological disorders, immunological including viral infections, cardiovascular, inflammatory, senses disorders, and cancer. The long ago discovered association between GPCRs and many endogenous and exogenous substances, resulting in e.g. analgesia, is another dynamically developing field of the pharmaceutical research.
Sources: en.wikipedia.org
Enzyme specificity refers to the interactions between any particular enzyme and its corresponding substrate. In addition to the specificity in binding its substrates, correct proximity and orientation as well as binding the transition state provide an additional layer of enzyme specificity. Enzymes vary in the specificity of the substrates that they bind to, in order to carry out specific physiological functions. Some enzymes may need to be less specific and therefore may bind to numerous substrates to catalyze a reaction. On the other hand, certain physiological functions require extreme specificity of the enzyme for a single specific substrate in order for a proper reaction and physiological phenotype to occur. The different types of categorizations differ based on their specificity for substrates. Most generally, they are divided into four groups: absolute, group, linkage, and stereochemical specificity.
S-Arrestin is a protein found in mice that binds to rhodopsin to stop its activity, preventing further signaling. S-arrestin binds to G protein-coupled receptors (GPCRs), like rhodopsin, following receptor activation and phosphorylation by G protein-coupled receptor kinases (GRKs). Rhodopsin is found in rod cells of the retina, essential for vision. It detects light and initiates a signaling cascade called phototransduction. However, excessive activation can be harmful, so it must be carefully regulated. The phosphorylation of the receptor's intracellular loops and C-terminal tail creates a high-affinity binding site for S-arrestin. S-arrestin then sterically hinders further G protein coupling, effectively desensitizing the receptor and directing it towards alternative signaling pathways or internalization via clathrin-mediated endocytosis.
Caspases play the central role in the transduction of ER apoptotic signals. Caspases are proteins that are highly conserved, cysteine-dependent aspartate-specific proteases. There are two types of caspases: initiator caspases (caspases 2, 8, 9, 10, 11, and 12) and effector caspases (caspases 3, 6, and 7). The activation of initiator caspases requires binding to specific oligomeric activator protein. These active initiator caspases activate the effector caspases through proteolytic cleavage. The active effector caspases then proteolytically degrade a host of intracellular proteins to carry out the cell death program. There also exists a caspase-independent apoptotic pathway that is mediated by AIF (apoptosis-inducing factor).
Sources: en.wikipedia.org
It means adding liquid to a lyophilized peptide powder so it dissolves into solution. The dry powder is not a finished liquid product, and the resulting concentration depends on the volume added. Complete dissolution should be visually confirmed before use.
Some peptides have hydrophobic regions or strong charge interactions that make water a poor solvent alone. A small amount of organic solvent, acid, or base may be needed before aqueous dilution. The appropriate approach depends on sequence and should be based on documented compatibility.
No. Solutions can degrade through hydrolysis, oxidation, aggregation, and microbial growth, and stability varies widely by peptide. Storage at reduced temperature and avoidance of repeated freeze-thaw cycles are common laboratory practices. Specific shelf lives are determined by stability testing, not by a general rule.
Short-term storage is often under refrigeration, while longer storage may use freezing at -20 °C or lower. The choice depends on peptide stability and the solvent. Dividing the solution into aliquots reduces repeated temperature changes.